Home Tools
Log in
Cart

Agouti-signaling Protein, Bovine, Recombinant (His)

Catalog No. TMPH-00221
Synonyms: ASP, ASIP, Agouti-signaling protein, Agouti switch protein

Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment).

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Agouti-signaling Protein, Bovine, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 491.00
100 μg 20 days $ 1,370.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment).
Species Bovine
Expression System Baculovirus
Tag N-terminal 10xHis-tagged
Accession Number Q29414
Synonyms ASP, ASIP, Agouti-signaling protein, Agouti switch protein
Amino Acid HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 23-133 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 14.9 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment).

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Agouti-signaling Protein, Bovine, Recombinant (His) ASP ASIP Agouti-signaling protein Agouti switch protein recombinant recombinant-proteins proteins protein

 

TargetMol