Shopping Cart
Remove All
Your shopping cart is currently empty
Uteroglobin Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q06318.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $92 | 7-10 days | 7-10 days | |
| 10 μg | $147 | 7-10 days | 7-10 days | |
| 20 μg | $223 | 7-10 days | 7-10 days | |
| 50 μg | $447 | 7-10 days | 7-10 days | |
| 100 μg | $732 | 7-10 days | 7-10 days | |
| 200 μg | $987 | 7-10 days | 7-10 days | |
| 500 μg | $1,650 | 7-10 days | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/m. |
| Description | Uteroglobin Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q06318. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q06318 |
| Synonyms | Utg,Uteroglobin,Ugb,Secretoglobin family 1A member 1,Scgb1a1,PCB-binding protein,Club cells 10 kDa secretory protein (CC10),Club cell phospholipid-binding protein (CCPBP),Club cell 17 kDa protein,Cc10 |
| Amino Acid | DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF |
| Construction | 22-96 aa |
| Protein Purity | >98% as determined by SDS-PAGE. |
| Molecular Weight | 16.7 kDa (Predicted), a disulfide-linked homodimeric protein containing two 75 amino acid residues polypeptide. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.