Renin receptor Protein, Human, Recombinant (His)

Name: Renin receptor Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02023
Rating: 4.5 (1 reviews)

(Synonyms: Vacuolar ATP synthase membrane sector-associated protein M8-9 (ATP6M8-9;V-ATPase M8.9 subunit), Renin/prorenin receptor, Renin receptor, N14F, ER-localized type I transmembrane adapter, Embryonic liver differentiation factor 10, ELDF10, CAPER, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase H(+)-transporting lysosomal accessory protein 2, ATP6IP2, ATP6AP2) Copy Product Info

Synonyms: Vacuolar ATP synthase membrane sector-associated protein M8-9 (ATP6M8-9;V-ATPase M8.9 subunit), Renin/prorenin receptor, Renin receptor, N14F, ER-localized type I transmembrane adapter, Embryonic liver differentiation factor 10, ELDF10, CAPER, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase H(+)-transporting lysosomal accessory protein 2, ATP6IP2, ATP6AP2

Catalog No. TMPH-02023 Copy Product Info

Renin receptor Protein, Human, Recombinant (His) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Renin receptor Protein, Human, Recombinant (His) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	O75787
Amino Acid	NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Construction	17-350 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Vacuolar ATP synthase membrane sector-associated protein M8-9 (ATP6M8-9;V-ATPase M8.9 subunit), Renin/prorenin receptor, Renin receptor, N14F, ER-localized type I transmembrane adapter, Embryonic liver differentiation factor 10, ELDF10, CAPER, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase H(+)-transporting lysosomal accessory protein 2, ATP6IP2, ATP6AP2
Research Background	Multifunctional protein which functions as a renin, prorenin cellular receptor and is involved in the assembly of the lysosomal proton-transporting V-type ATPase (v-ATPase) and the acidification of the endo-lysosomal system. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, may also play a role in the renin-angiotensin system (RAS). Through its function in V-type ATPase (v-ATPase) assembly and acidification of the lysosome it regulates protein degradation and may control different signaling pathways important for proper brain development, synapse morphology and synaptic transmission.

Chemical Properties

Molecular Weight

41.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.