HINT1 Protein, Rabbit, Recombinant (His & Myc)

Name: HINT1 Protein, Rabbit, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-03205
Rating: 4.5 (1 reviews)

(Synonyms: P13.7, Histidine triad nucleotide-binding protein 1, HINT1, HINT, Desumoylating isopeptidase HINT1, Adenosine 5'-monophosphoramidase HINT1) Copy Product Info

Synonyms: P13.7, Histidine triad nucleotide-binding protein 1, HINT1, HINT, Desumoylating isopeptidase HINT1, Adenosine 5'-monophosphoramidase HINT1

Catalog No. TMPH-03205 Copy Product Info

HINT1 Protein, Rabbit, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 17.6 kDa and the accession number is P80912.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$197	20 days	20 days
10 µg	$327	20 days	20 days
20 µg	$549	20 days	20 days
50 µg	$987	20 days	20 days
100 µg	$1,690	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	HINT1 Protein, Rabbit, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 17.6 kDa and the accession number is P80912.
Species	Rabbit
Expression System	HEK293 Cells
Tag	N-10xHis, C-Myc
Accession Number	P80912
Amino Acid	ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
Construction	2-126 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	P13.7, Histidine triad nucleotide-binding protein 1, HINT1, HINT, Desumoylating isopeptidase HINT1, Adenosine 5'-monophosphoramidase HINT1
Research Background	Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2. Hydrolyzes adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase. Hydrolyzes Met-AMP, His-AMP, Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide. In addition, functions as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex. Also exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RANGAP1 and RGS17.

Chemical Properties

Molecular Weight

17.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.