Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

HUWE1 Protein, Human, Recombinant (His & Myc)

TargetMol | SPR
Catalog No. TMPH-04659 Copy Product Info
HUWE1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. The accession number is Q7Z6Z7.

HUWE1 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-04659
Copy Product Info
TargetMol | SPR

HUWE1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. The accession number is Q7Z6Z7.

HUWE1 Protein, Human, Recombinant (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$143-In Stock
10 μg$23520 days20 days
20 μg$393-In Stock
50 μg$56820 days20 days
100 μg$75620 days20 days
200 μg$1,08020 days20 days
500 μg$1,76020 days20 days
1 mg$2,55020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
HUWE1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. The accession number is Q7Z6Z7.
Species
Human
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberQ7Z6Z7
Synonyms
UREB1,Upstream regulatory element-binding protein 1 (URE-B1;URE-binding protein 1),Mcl-1 ubiquitin ligase E3 (Mule),Large structure of UREB1 (LASU1),KIAA1578,KIAA0312,HUWE1,Homologous to E6AP carboxyl terminus homologous protein 9 (HectH9),HECT-type E3 ubiquitin transferase HUWE1,HECT, UBA and WWE domain-containing protein 1,E3 ubiquitin-protein ligase HUWE1,ARF-binding protein 1 (ARF-BP1)
Amino Acid
LERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
Construction
4005-4374 aa
Protein Purity
> 90% as determined by SDS-PAGE.
HUWE1 Protein, Human, Recombinant (His & Myc)
Molecular Weight50.7 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 296 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords