Shopping Cart
Remove All
Your shopping cart is currently empty
HUWE1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. The accession number is Q7Z6Z7.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $143 | - | In Stock | |
| 10 μg | $235 | 20 days | 20 days | |
| 20 μg | $393 | - | In Stock | |
| 50 μg | $568 | 20 days | 20 days | |
| 100 μg | $756 | 20 days | 20 days | |
| 200 μg | $1,080 | 20 days | 20 days | |
| 500 μg | $1,760 | 20 days | 20 days | |
| 1 mg | $2,550 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | HUWE1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. The accession number is Q7Z6Z7. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q7Z6Z7 |
| Synonyms | UREB1,Upstream regulatory element-binding protein 1 (URE-B1;URE-binding protein 1),Mcl-1 ubiquitin ligase E3 (Mule),Large structure of UREB1 (LASU1),KIAA1578,KIAA0312,HUWE1,Homologous to E6AP carboxyl terminus homologous protein 9 (HectH9),HECT-type E3 ubiquitin transferase HUWE1,HECT, UBA and WWE domain-containing protein 1,E3 ubiquitin-protein ligase HUWE1,ARF-binding protein 1 (ARF-BP1) |
| Amino Acid | LERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA |
| Construction | 4005-4374 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 50.7 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 296 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.