PML Protein, Human, Recombinant (His & Myc)

(Synonyms: Tripartite motif-containing protein 19 (TRIM19), TRIM19, RNF71, RING-type E3 SUMO transferase PML, RING finger protein 71, Protein PML, Promyelocytic leukemia protein, PP8675, PML, MYL, E3 SUMO-protein ligase PML) Copy Product Info

Synonyms: Tripartite motif-containing protein 19 (TRIM19), TRIM19, RNF71, RING-type E3 SUMO transferase PML, RING finger protein 71, Protein PML, Promyelocytic leukemia protein, PP8675, PML, MYL, E3 SUMO-protein ligase PML

Catalog No. TMPH-01949 Copy Product Info

PML Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 24.5 kDa and the accession number is P29590.

Pack Size	Price	USA Stock	Global Stock
5 μg	$176	20 days	20 days
10 μg	$293	20 days	20 days
20 μg	$491	20 days	20 days
50 μg	$926	20 days	20 days
100 μg	$1,500	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PML Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 24.5 kDa and the accession number is P29590.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	P29590
Amino Acid	QCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEE
Construction	59-239 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Tripartite motif-containing protein 19 (TRIM19), TRIM19, RNF71, RING-type E3 SUMO transferase PML, RING finger protein 71, Protein PML, Promyelocytic leukemia protein, PP8675, PML, MYL, E3 SUMO-protein ligase PML
Research Background

Chemical Properties

Molecular Weight

24.5 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

TRIM 19RNF 71PP 8675

Related Tags: PML Protein, Human, Recombinant (His & Myc) chemical structure | PML Protein, Human, Recombinant (His & Myc) molecular weight