Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

PZP Protein, Human, Recombinant (His)

Name: PZP Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01896
Rating: 4.5 (1 reviews)

(Synonyms: PZP, Pregnancy zone protein, CPAMD6, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6) Copy Product Info

Synonyms: PZP, Pregnancy zone protein, CPAMD6, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6

Catalog No. TMPH-01896 Copy Product Info

PZP Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is P20742.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$75	20 days	20 days
10 μg	$119	20 days	20 days
20 μg	$198	20 days	20 days
50 μg	$297	20 days	20 days
100 μg	$427	20 days	20 days
200 μg	$658	20 days	20 days
500 μg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:92%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PZP Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is P20742.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P20742
Amino Acid	MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG
Construction	472-821 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	PZP, Pregnancy zone protein, CPAMD6, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6
Research Background

Chemical Properties

Molecular Weight

42.3 kDa (predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

CPAMD 6C3 and PZP-like α-2-macroglobulin domain-containing protein 6C3 and PZP-like a-2-macroglobulin domain-containing protein 6

Related Tags: PZP Protein, Human, Recombinant (His) chemical structure | PZP Protein, Human, Recombinant (His) molecular weight