DNASE1L2 Protein, Human, Recombinant (His & Myc)

Name: DNASE1L2 Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-03887
Rating: 4.5 (1 reviews)

(Synonyms: DNASE1L2, DNase I homolog protein DHP1, DNAS1L2, DHP1, Deoxyribonuclease-1-like 2, Deoxyribonuclease I-like 2 (DNase I-like 2)) Copy Product Info

Synonyms: DNASE1L2, DNase I homolog protein DHP1, DNAS1L2, DHP1, Deoxyribonuclease-1-like 2, Deoxyribonuclease I-like 2 (DNase I-like 2)

Catalog No. TMPH-03887 Copy Product Info

DNASE1L2 Protein, Human, Recombinant (His & Myc) is expressed in E. coli with N-10xHis, C-Myc. The accession number is Q92874.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	20 days	20 days
10 μg	$216	20 days	20 days
20 μg	$360	20 days	20 days
50 μg	$516	20 days	20 days
100 μg	$678	20 days	20 days
200 μg	$978	20 days	20 days
500 μg	$1,590	20 days	20 days
1 mg	$2,300	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	DNASE1L2 Protein, Human, Recombinant (His & Myc) is expressed in E. coli with N-10xHis, C-Myc. The accession number is Q92874.
Species	Human
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q92874
Amino Acid	ALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR
Construction	21-299 aa
Protein Purity	>90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	DNASE1L2, DNase I homolog protein DHP1, DNAS1L2, DHP1, Deoxyribonuclease-1-like 2, Deoxyribonuclease I-like 2 (DNase I-like 2)

Chemical Properties

Molecular Weight

38.4 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

DNaseI-like2DNASE1L 2DNase I-like 2DNAS1L 2DHP 1

Related Tags: DNASE1L2 Protein, Human, Recombinant (His & Myc) chemical structure | DNASE1L2 Protein, Human, Recombinant (His & Myc) molecular weight