Shopping Cart
Remove All
Your shopping cart is currently empty
Prolactin Releasing Peptide (1-31), human, is a high-affinity GPR10 ligand that induces prolactin release. It binds to GPR10 with Kis of 1.03 nM in humans and 0.33 nM in rats. Prolactin-releasing peptide is a specific prolactin-releasing peptide.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 500 μg | $1,290 | 35 days | 35 days |
| Description | Prolactin Releasing Peptide (1-31), human, is a high-affinity GPR10 ligand that induces prolactin release. It binds to GPR10 with Kis of 1.03 nM in humans and 0.33 nM in rats. Prolactin-releasing peptide is a specific prolactin-releasing peptide. |
| Molecular Weight | 3664.15 |
| Formula | C160H252N56O42S |
| Cas No. | 215510-22-8 |
| Relative Density. | no data available |
| Sequence | Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Sequence Short | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.