APOLD1 Protein, Human, Recombinant (His)

Name: APOLD1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00949
Rating: 4.5 (1 reviews)

(Synonyms: VERGE, Vascular early response gene protein, Apolipoprotein L domain-containing protein 1, APOLD1) Copy Product Info

Synonyms: VERGE, Vascular early response gene protein, Apolipoprotein L domain-containing protein 1, APOLD1

Catalog No. TMPH-00949 Copy Product Info

May be involved in angiogenesis. May play a role in activity-dependent changes of brain vasculature. May affect blood-brain permeability. APOLD1 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 33.4 kDa and the accession number is Q96LR9.

APOLD1 Protein, Human, Recombinant (His)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$526	20 days	20 days
10 µg	$886	20 days	20 days
20 µg	$1,500	20 days	20 days
50 µg	$2,090	20 days	20 days
100 µg	$2,750	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	May be involved in angiogenesis. May play a role in activity-dependent changes of brain vasculature. May affect blood-brain permeability. APOLD1 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 33.4 kDa and the accession number is Q96LR9.
Species	Human
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q96LR9
Amino Acid	MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
Construction	1-279 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	VERGE, Vascular early response gene protein, Apolipoprotein L domain-containing protein 1, APOLD1
Research Background	May be involved in angiogenesis. May play a role in activity-dependent changes of brain vasculature. May affect blood-brain permeability.

Chemical Properties

Molecular Weight

33.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.