Hantaan virus (strain 76-118) Envelopment polyprotein (His)

Catalog No. TMPH-00790

Hantaan virus (strain 76-118) Envelopment polyprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 52.7 kDa and the accession number is P08668.

Hantaan virus (strain 76-118) Envelopment polyprotein (His)

Catalog No. TMPH-00790

Hantaan virus (strain 76-118) Envelopment polyprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 52.7 kDa and the accession number is P08668.

Pack Size	Price	Availability	Quantity
20 μg	$614	20 days
100 μg	$1,890	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Hantaan virus (strain 76-118) Envelopment polyprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 52.7 kDa and the accession number is P08668.
Species	HTNV
Expression System	HEK293 Cells
Tag	C-6xHis
Accession Number	P08668
Synonyms	M polyprotein,GP,Glycoprotein precursor,Envelopment polyprotein
Amino Acid	SETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHLDKVNGISEIENSKVYDDGAPQCGIKCWFVKSGEWISGIFSGN
Construction	649-1105 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	52.7 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Forms homotetramers with glycoprotein C at the surface of the virion. Attaches the virion to host cell receptors including integrin beta3/ITGB3. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion. May dysregulate normal immune and endothelial cell responses through an ITAM motif.; Forms homotetramers with glycoprotein N at the surface of the virion. Attaches the virion to host cell receptors including integrin beta3/ITGB3. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion.