Shopping Cart
Remove All
Your shopping cart is currently empty
Hantaan virus (strain 76-118) Envelopment polyprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 52.7 kDa and the accession number is P08668.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $219 | 20 days | 20 days | |
| 10 μg | $365 | 20 days | 20 days | |
| 20 μg | $613 | 20 days | 20 days | |
| 50 μg | $1,160 | 20 days | 20 days | |
| 100 μg | $1,890 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Hantaan virus (strain 76-118) Envelopment polyprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 52.7 kDa and the accession number is P08668. |
| Species | HTNV |
| Expression System | HEK293 Cells |
| Tag | C-6xHis |
| Accession Number | P08668 |
| Synonyms | M polyprotein,GP,Glycoprotein precursor,Envelopment polyprotein |
| Amino Acid | SETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHLDKVNGISEIENSKVYDDGAPQCGIKCWFVKSGEWISGIFSGN |
| Construction | 649-1105 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 52.7 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Forms homotetramers with glycoprotein C at the surface of the virion. Attaches the virion to host cell receptors including integrin beta3/ITGB3. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion. May dysregulate normal immune and endothelial cell responses through an ITAM motif.; Forms homotetramers with glycoprotein N at the surface of the virion. Attaches the virion to host cell receptors including integrin beta3/ITGB3. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.