Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: TXNL5, TXNDC17, Thioredoxin-like protein 5, Thioredoxin domain-containing protein 17, Protein 42-9-9, 14 kDa thioredoxin-related protein (TRP14)

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $75 | 20 days | 20 days | |
| 10 µg | $119 | 20 days | 20 days | |
| 20 µg | $198 | 20 days | 20 days | |
| 50 µg | $297 | 20 days | 20 days | |
| 100 µg | $427 | 20 days | 20 days | |
| 200 µg | $658 | 20 days | 20 days | |
| 500 µg | $1,170 | 20 days | 20 days | |
| 1 mg | $1,830 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-GST |
| Accession Number | Q9BRA2 |
| Amino Acid | MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED |
| Construction | 1-123 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | TXNL5, TXNDC17, Thioredoxin-like protein 5, Thioredoxin domain-containing protein 17, Protein 42-9-9, 14 kDa thioredoxin-related protein (TRP14) |
| Research Background | Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide. |
| Molecular Weight | 40.9 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.