EIF3M Protein, Human, Recombinant (His & SUMO)

Name: EIF3M Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-01311
Rating: 4.5 (1 reviews)

(Synonyms: PCID1, PCI domain-containing protein 1, HFLB5, Fetal lung protein B5 (hFL-B5), Eukaryotic translation initiation factor 3 subunit M, EIF3M) Copy Product Info

Synonyms: PCID1, PCI domain-containing protein 1, HFLB5, Fetal lung protein B5 (hFL-B5), Eukaryotic translation initiation factor 3 subunit M, EIF3M

Catalog No. TMPH-01311 Copy Product Info

EIF3M Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 58.4 kDa and the accession number is Q7L2H7.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	EIF3M Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 58.4 kDa and the accession number is Q7L2H7.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q7L2H7
Amino Acid	SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT
Construction	2-374 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	PCID1, PCI domain-containing protein 1, HFLB5, Fetal lung protein B5 (hFL-B5), Eukaryotic translation initiation factor 3 subunit M, EIF3M
Research Background	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.; (Microbial infection) May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2).

Chemical Properties

Molecular Weight

58.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.