CREBBP Protein, Human, Recombinant (GST)

Name: CREBBP Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-01158
Rating: 4.5 (1 reviews)

(Synonyms: Protein-lysine acetyltransferase CREBBP, Protein lactyltransferas CREBBP, Histone lysine acetyltransferase CREBBP, CREBBP, CREB-binding protein, CBP) Copy Product Info

Synonyms: Protein-lysine acetyltransferase CREBBP, Protein lactyltransferas CREBBP, Histone lysine acetyltransferase CREBBP, CREBBP, CREB-binding protein, CBP

Catalog No. TMPH-01158 Copy Product Info

CREBBP Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 40.7 kDa and the accession number is Q92793.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$89	20 days	20 days
10 µg	$143	20 days	20 days
20 µg	$237	-	In Stock
50 µg	$358	20 days	20 days
100 µg	$490	20 days	20 days
200 µg	$755	20 days	20 days
500 µg	$1,330	20 days	20 days
1 mg	$2,080	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:Greater than 85% as determined by SDS-PAGE.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CREBBP Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 40.7 kDa and the accession number is Q92793.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	Q92793
Amino Acid	RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Construction	1081-1197 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Protein-lysine acetyltransferase CREBBP, Protein lactyltransferas CREBBP, Histone lysine acetyltransferase CREBBP, CREBBP, CREB-binding protein, CBP
Research Background	Acetylates histones, giving a specific tag for transcriptional activation. Also acetylates non-histone proteins, like DDX21, FBL, IRF2, MAFG, NCOA3, POLR1E/PAF53 and FOXO1. Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1. Acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators: NPAS2-ARNTL/BMAL1 and CLOCK-ARNTL/BMAL1 heterodimers. Acetylates PCNA; acetylation promotes removal of chromatin-bound PCNA and its degradation during nucleotide excision repair (NER). Acetylates POLR1E/PAF53, leading to decreased association of RNA polymerase I with the rDNA promoter region and coding region. Acetylates DDX21, thereby inhibiting DDX21 helicase activity. Acetylates FBL, preventing methylation of 'Gln-105' of histone H2A (H2AQ104me). Functions as a transcriptional coactivator for SMAD4 in the TGF-beta signaling pathway.

Chemical Properties

Molecular Weight

40.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.