btuF Protein, E. coli, Recombinant (His)

Name: btuF Protein, E. coli, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04720
Rating: 4.5 (1 reviews)

(Synonyms: yadT, Vitamin B12-binding protein, btuF) Copy Product Info

Synonyms: yadT, Vitamin B12-binding protein, btuF

Catalog No. TMPH-04720 Copy Product Info

btuF Protein, E. coli, Recombinant (His) is expressed in E. coli. The accession number is P37028.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$235	20 days	20 days
20 μg	$393	20 days	20 days
50 μg	$568	20 days	20 days
100 μg	$756	20 days	20 days
200 μg	$1,080	20 days	20 days
500 μg	$1,760	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	btuF Protein, E. coli, Recombinant (His) is expressed in E. coli. The accession number is P37028.
Species	E. coli (strain K12)
Expression System	E. coli
Tag	N-6xHis
Accession Number	P37028
Amino Acid	PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Construction	24-266 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 357 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	yadT, Vitamin B12-binding protein, btuF

Chemical Properties

Molecular Weight

30.9 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: btuF Protein, E. coli, Recombinant (His) chemical structure | btuF Protein, E. coli, Recombinant (His) molecular weight