Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: mpt44, Fibronectin-binding protein A (Fbps A), fbpA, Diacylglycerol acyltransferase/mycolyltransferase Ag85A, DGAT, Antigen 85 complex A (85A;Ag85A), Acyl-CoA:diacylglycerol acyltransferase

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | 20 days | 20 days | |
| 10 µg | $216 | 20 days | 20 days | |
| 20 µg | $360 | 20 days | 20 days | |
| 50 µg | $543 | 20 days | 20 days | |
| 100 µg | $745 | 20 days | 20 days | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Ag85A Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 44.6 kDa and the accession number is P9WQP2. |
| Species | Mycobacterium tuberculosis |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P9WQP2 |
| Amino Acid | FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA |
| Construction | 44-338 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | mpt44, Fibronectin-binding protein A (Fbps A), fbpA, Diacylglycerol acyltransferase/mycolyltransferase Ag85A, DGAT, Antigen 85 complex A (85A;Ag85A), Acyl-CoA:diacylglycerol acyltransferase |
| Research Background | The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor. |
| Molecular Weight | 44.6 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.