IgG-binding protein G, Streptococci group G, Recombinant (His)

Name: IgG-binding protein G, Streptococci group G, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04379
Rating: 4.5 (1 reviews)

(Synonyms: spg, Immunoglobulin G-binding protein G, IgG-binding protein G) Copy Product Info

Synonyms: spg, Immunoglobulin G-binding protein G, IgG-binding protein G

Catalog No. TMPH-04379 Copy Product Info

IgG-binding protein G, Streptococci group G, Recombinant (His) is expressed in E. coli. The accession number is P19909.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$98	20 days	20 days
10 μg	$159	20 days	20 days
20 μg	$266	20 days	20 days
50 μg	$378	20 days	20 days
100 μg	$498	20 days	20 days
200 μg	$769	20 days	20 days
500 μg	$1,370	20 days	20 days
1 mg	$2,130	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	IgG-binding protein G, Streptococci group G, Recombinant (His) is expressed in E. coli. The accession number is P19909.
Species	Streptococcus sp. group G
Expression System	E. coli
Tag	N-10xHis
Accession Number	P19909
Amino Acid	IDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Construction	291-497 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 16 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	spg, Immunoglobulin G-binding protein G, IgG-binding protein G

Chemical Properties

Molecular Weight

29.4 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

IgGbinding protein G

Related Tags: IgG-binding protein G, Streptococci group G, Recombinant (His) chemical structure | IgG-binding protein G, Streptococci group G, Recombinant (His) molecular weight