NLRP3 Protein, Human, Recombinant (His)

Name: NLRP3 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01739
Rating: 4.5 (1 reviews)

(Synonyms: PYRIN-containing APAF1-like protein 1, PYPAF1, NLRP3, NALP3, NACHT, LRR and PYD domains-containing protein 3, LRR and PYD domains-containing protein 3, Cryopyrin, Cold-induced autoinflammatory syndrome 1 protein, CIAS1, Caterpiller protein 1.1 (CLR1.1), C1orf7, Angiotensin/vasopressin receptor AII/AVP-like) Copy Product Info

Synonyms: PYRIN-containing APAF1-like protein 1, PYPAF1, NLRP3, NALP3, NACHT, LRR and PYD domains-containing protein 3, LRR and PYD domains-containing protein 3, Cryopyrin, Cold-induced autoinflammatory syndrome 1 protein, CIAS1, Caterpiller protein 1.1 (CLR1.1), C1orf7, Angiotensin/vasopressin receptor AII/AVP-like

Catalog No. TMPH-01739 Copy Product Info

NLRP3 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.7 kDa and the accession number is Q96P20.

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	-	In Stock
20 µg	$283	In Stock	In Stock
50 µg	$428	20 days	20 days
100 µg	$590	-	In Stock
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	NLRP3 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.7 kDa and the accession number is Q96P20.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q96P20
Amino Acid	LEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFDPDDEHSEPVHTVVFQGAAGIG
Construction	29-231 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	PYRIN-containing APAF1-like protein 1, PYPAF1, NLRP3, NALP3, NACHT, LRR and PYD domains-containing protein 3, LRR and PYD domains-containing protein 3, Cryopyrin, Cold-induced autoinflammatory syndrome 1 protein, CIAS1, Caterpiller protein 1.1 (CLR1.1), C1orf7, Angiotensin/vasopressin receptor AII/AVP-like
Research Background	As the sensor component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. In response to pathogens and other damage-associated signals, initiates the formation of the inflammasome polymeric complex, made of NLRP3, PYCARD and CASP1 (and possibly CASP4 and CASP5). Recruitment of proCASP1 to the inflammasome promotes its activation and CASP1-catalyzed IL1B and IL18 maturation and secretion in the extracellular milieu. Activation of NLRP3 inflammasome is also required for HMGB1 secretion. The active cytokines and HMGB1 stimulate inflammatory responses. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death. Under resting conditions, NLRP3 is autoinhibited. NLRP3 activation stimuli include extracellular ATP, reactive oxygen species, K(+) efflux, crystals of monosodium urate or cholesterol, amyloid-beta fibers, environmental or industrial particles and nanoparticles, cytosolic dsRNA, etc. However, it is unclear what constitutes the direct NLRP3 activator. Activation in presence of cytosolic dsRNA is mediated by DHX33. Independently of inflammasome activation, regulates the differentiation of T helper 2 (Th2) cells and has a role in Th2 cell-dependent asthma and tumor growth. During Th2 differentiation, required for optimal IRF4 binding to IL4 promoter and for IRF4-dependent IL4 transcription. Binds to the consensus DNA sequence 5'-GRRGGNRGAG-3'. May also participate in the transcription of IL5, IL13, GATA3, CCR3, CCR4 and MAF.

Chemical Properties

Molecular Weight

27.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.