Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

MBD2 Protein, Human, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04607 Copy Product Info
MBD2 Protein, Human, Recombinant (hFc) is expressed in Yeast. The accession number is Q9UBB5.

MBD2 Protein, Human, Recombinant (hFc)

Catalog No. TMPH-04607
Copy Product Info
TargetMol | SPR

MBD2 Protein, Human, Recombinant (hFc) is expressed in Yeast. The accession number is Q9UBB5.

MBD2 Protein, Human, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$13920 days20 days
10 μg$22920 days20 days
20 μg$38220 days20 days
50 μg$54720 days20 days
100 μg$72020 days20 days
200 μg$1,08020 days20 days
500 μg$1,93020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
MBD2 Protein, Human, Recombinant (hFc) is expressed in Yeast. The accession number is Q9UBB5.
Species
Human
Expression System
P. pastoris (Yeast)
TagC-hFc
Accession NumberQ9UBB5
Synonyms
Methyl-CpG-binding protein MBD2,Methyl-CpG-binding domain protein 2,MBD2,Demethylase (DMTase)
Amino Acid
ESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Construction
145-411 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight56.3 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 244 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords