GPR20 Protein-VLP, Human, Recombinant (His)

Name: GPR20 Protein-VLP, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03943
Rating: 4.5 (1 reviews)

(Synonyms: G-protein coupled receptor 20, GPR20) Copy Product Info

Synonyms: G-protein coupled receptor 20, GPR20

Catalog No. TMPH-03943 Copy Product Info

GPR20 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is Q99678.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$289	20 days	20 days
10 μg	$483	20 days	20 days
20 μg	$815	20 days	20 days
50 μg	$1,270	20 days	20 days
100 μg	$1,790	20 days	20 days
200 μg	$2,990	20 days	20 days
500 μg	$5,890	20 days	20 days
1 mg	$9,870	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC50 is 2.431 - 3.239 ng/mL.The VLPs (CSB-MP3838) is negative control.
Description	GPR20 Protein-VLP, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is Q99678.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis (This tag can be tested only under denaturing conditions)
Accession Number	Q99678
Amino Acid	MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Construction	1-358 aa
Protein Purity	The purity information is not available for VLPs proteins.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	G-protein coupled receptor 20, GPR20

Chemical Properties

Molecular Weight

40.0 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

GPR 20

Related Tags: GPR20 Protein-VLP, Human, Recombinant (His) chemical structure | GPR20 Protein-VLP, Human, Recombinant (His) molecular weight