Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LRPPRC Protein, Human, Recombinant (His)

Catalog No. TMPH-04617

LRPPRC Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42704.

LRPPRC Protein, Human, Recombinant (His)

LRPPRC Protein, Human, Recombinant (His)

Catalog No. TMPH-04617
LRPPRC Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42704.
Pack SizePriceAvailabilityQuantity
5 μg$14320 days
10 μg$23520 days
20 μg$39320 days
50 μg$56820 days
100 μg$75620 days
200 μg$1,08020 days
500 μg$1,76020 days
1 mg$2,55020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LRPPRC Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42704.
Species
Human
Expression System
E. coli
TagN-6xHis
Accession NumberP42704
Synonyms
LRPPRC,LRP130,Leucine-rich PPR motif-containing protein, mitochondrial,GP130,130 kDa leucine-rich protein (LRP 130)
Amino Acid
LFRKVIEEQLEPAVEKISIMAERLANQFAIYKPVTDFFLQLVDAGKVDDARALLQRCGAIAEQTPILLLFLLRNSRKQGKASTVKSVLELIPELNEKEEAYNSLMKSYVSEKDVTSAKALYEHLTAKNTKLDDLFLKRYASLLKYAGEPVPFIEPPESFEFYAQQLRKLRENSS
Construction
1221-1394 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight26.8 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 254 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords