LRPPRC Protein, Human, Recombinant (His)

Name: LRPPRC Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04617
Rating: 4.5 (1 reviews)

(Synonyms: LRPPRC, LRP130, Leucine-rich PPR motif-containing protein, mitochondrial, GP130, 130 kDa leucine-rich protein (LRP 130)) Copy Product Info

Synonyms: LRPPRC, LRP130, Leucine-rich PPR motif-containing protein, mitochondrial, GP130, 130 kDa leucine-rich protein (LRP 130)

Catalog No. TMPH-04617 Copy Product Info

LRPPRC Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42704.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$143	20 days	20 days
10 µg	$235	20 days	20 days
20 µg	$393	20 days	20 days
50 µg	$568	20 days	20 days
100 µg	$756	20 days	20 days
200 µg	$1,080	20 days	20 days
500 µg	$1,760	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	LRPPRC Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42704.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P42704
Amino Acid	LFRKVIEEQLEPAVEKISIMAERLANQFAIYKPVTDFFLQLVDAGKVDDARALLQRCGAIAEQTPILLLFLLRNSRKQGKASTVKSVLELIPELNEKEEAYNSLMKSYVSEKDVTSAKALYEHLTAKNTKLDDLFLKRYASLLKYAGEPVPFIEPPESFEFYAQQLRKLRENSS
Construction	1221-1394 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	LRPPRC, LRP130, Leucine-rich PPR motif-containing protein, mitochondrial, GP130, 130 kDa leucine-rich protein (LRP 130)

Chemical Properties

Molecular Weight

26.8 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 254 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.