derivative

Epirubicin hydrochloride (Pharmorubicin) is an adriamycin derivative, a topoisomerase (Topo) inhibitor, and a Forkhead box protein p3 (Foxp3) inhibitor. Epirubicin hydrochloride has antitumor activity.

Colcemid (NSC-3096) is an inhibitor of microtubule polymerization. It used to study embryonic cloning.

Norbergenin is a chemical compound. It is the O-demethylated derivative of bergenin. It can be isolated from rhizomes of Bergenia stracheyi.

L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.

Benzamide Derivative 1 Benzamide derivative with gastrokinetic activity.Benzamide Derivative 1 can be used in the study of gastrointestinal diseases.

Indirubin Derivative E804 is a potent insulin-like growth factor type 1 receptor (IGF1R) inhibitor with potential antitumor activity.

Helioxanthin derivative 5-4-2 (Helioxanthin 5-4-2) is an analogue of helioxanthin that shows anti-HBV activity in vitro and can be used to study HBV.

3-arylisoquinolinamine derivative is a compound with antitumor activity.

DOTA derivatives are phenoxy derivatives of cyclic Tosamide;Direct nitrification;It is more convenient to add nitro group after removing the protection of lithium aluminium hydride.

Betulinic acid derivative-1 demonstrates potent inhibition of osteoclast (OC) differentiation, achieving an IC50 value of 1.86 μM.

This peptide is a potent humanin (HN) derivative. It completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.

Oleanolic acid derivative 2 is a derivative of oleanolic acid.

Kobusine derivative-1, a variant of Kobusine, exhibits antiproliferative effects on cancer cells [1].

Cyclosporin A-Derivative 3 is a derivative of Cyclosporin A with calcineurin inhibition [1] .

Cyclosporin A-Derivative 1 (Free base) is a crystalline intermediate obtained from cyclosporin A via ring-opening.

Diarylalkane derivative 1 is utilized in pancreatitis research.

Carbazole derivative 1 is used to reduce androgen or oestrogen levels in mammals.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Derivative 2 is A novel Derivative of Cyclosporin A.Cyclosporin A is an immunosuppressant that binds to cyclophilin and inhibits calcineurin.

OT antagonist 1 demethyl derivative, a demethyl derivative of OT antagonist 1, is a selective Oxytocin antagonist with a Ki of 50 nM.

Ebselen derivative 1 (Compound 19), an orally active glutathione peroxidase (GPx) mimic, exhibits notable protective effects against cisplatin-induced hair cell (HC) damage in both in vitro and in vivo settings. It significantly reduces oxidative stress, apoptosis, and ferroptosis in hair cells, making it useful in the study of cisplatin-induced hearing loss [1].

Hydrocarbon chain derivative 1 has inhibitory activities against lipid synthesis.

Benzylbenzofuran Derivative-1 (Compound 8), a benzylbenzofuran derivative, is isolatable from Silene conoidea [1].

Maytansine derivative M24 is a drug-linker conjugate used in the production of the antibody-drug conjugate (ADC), specifically ADC REGN5093-M114.