derivative

3-arylisoquinolinamine derivative is a compound with antitumor activity.

Hydrocarbon chain derivative 1 has inhibitory activities against lipid synthesis.

OT antagonist 1 demethyl derivative, a demethyl derivative of OT antagonist 1, is a selective Oxytocin antagonist with a Ki of 50 nM.

Pyrrole-derivative1 is used for the research of the diabetic disease.

Heterocyclyl carbamate derivative 1, a heterocyclyl carbamate derivative, is used for the research of neurological diseases and inflammatory.

Diarylalkane derivative 1 is utilized in pancreatitis research.

Pyridazinediones-derivative-1 shows potential in the treatment of neurodegenerative disorders.

Carbazole derivative 1 is used to reduce androgen or oestrogen levels in mammals.

DOTA derivatives are phenoxy derivatives of cyclic Tosamide;Direct nitrification;It is more convenient to add nitro group after removing the protection of lithium aluminium hydride.

Oleanolic acid derivative 1 is a modified form of oleanolic acid.

Oleanolic acid derivative 2 is a derivative of oleanolic acid.

Glycerol derivative 1 is a compound named [(1R)-1-[(2S)-2-(hexadecanoyloxy)-3-(hexadecanoyloxy)propoxy]-1-(hydroxymethyl)ethyl] hexadecanoate, characterized as odorless and tasteless. It appears as a white or cream-colored powder and is insoluble in water, but highly soluble in (methanol).

(S,R,S)-AHPC-Boc derivative 1 (Compound 80-9; VH032-Boc derivative 1) is a selective proteasomal degrader targeting MALT1, which recruits the E3 ubiquitin ligase CRBN to form a ternary complex with MALT1. This interaction leads to the ubiquitination and subsequent proteasomal degradation of MALT1. By disrupting the CBM complex, (S,R,S)-AHPC-Boc derivative 1 inhibits the NF-κB signaling pathway and shows potential in inducing apoptosis in ABC-DLBCL cells. It holds promise for research into MALT1-dependent cancers, such as diffuse large B-cell lymphoma (DLBCL).

Hemiasterlin Derivative-1, a derivative of hemiasterlin, is utilized in the synthesis of Antibody-Drug Conjugates (ADC).

Betulinic acid derivative-1 demonstrates potent inhibition of osteoclast (OC) differentiation, achieving an IC50 value of 1.86 μM.

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Derivative 2 is A novel Derivative of Cyclosporin A.Cyclosporin A is an immunosuppressant that binds to cyclophilin and inhibits calcineurin.

Exendin derivative 1, a 39-amino acid peptide, is a chemical compound known for its significant biological activity and therapeutic potential.

This peptide is a potent humanin (HN) derivative. It completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.

Cyclosporin A-Derivative 1, a crystalline intermediate, is derived from the opening of cyclosporin A.

Threonine-derivative-CoA (Threonine derivative-coenzyme A) is a derivative of coenzyme A.

Helioxanthin derivative 5-4-2 (Helioxanthin 5-4-2) is an analogue of helioxanthin that shows anti-HBV activity in vitro and can be used to study HBV.

Indirubin Derivative E804 is a potent insulin-like growth factor type 1 receptor (IGF1R) inhibitor with potential antitumor activity.