Your shopping cart is currently empty

ANK peptide is a novel peptide designed based on the conserved residue of a single-anchored protein motif. It acts as an inhibitor of γ-synuclein (SNCG) by binding to SNCG, thereby competing with and disrupting the SNCG-BubR1 interaction. This action enhances the sensitivity of breast cancer cells to antimicrotubule agents such as nocodazole and paclitaxel. ANK peptide is useful for tumor research.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | ANK peptide is a novel peptide designed based on the conserved residue of a single-anchored protein motif. It acts as an inhibitor of γ-synuclein (SNCG) by binding to SNCG, thereby competing with and disrupting the SNCG-BubR1 interaction. This action enhances the sensitivity of breast cancer cells to antimicrotubule agents such as nocodazole and paclitaxel. ANK peptide is useful for tumor research. |
| Molecular Weight | 3600.01 |
| Formula | C152H244N52O46S2 |
| Cas No. | 929207-58-9 |
| Smiles | [C@@H](CC1=CN=CN1)(NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@H](CCCCN)N)=O)=O)CC(N)=O)=O)CO)=O)C)=O)CC(C)C)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC2=CN=CN2)C(NCC(N[C@@H](CC3=CN=CN3)C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC4=CC=C(O)C=C4)C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC5=CN=CN5)C(NCC(O)=O)=O)=O)CC(N)=O)=O)CCC(N)=O)=O)CCSC)=O)[C@@H](C)O)=O)C(C)C)=O)CC(N)=O)=O)C)=O)=O)=O)CCCNC(=N)N)=O)C(C)C)=O)CC(C)C)=O)[C@@H](C)O)=O)CCC(N)=O)=O)[C@H](CC)C)=O)CS)=O)=O)CC(C)C)=O)=O)=O)=O)CCC(N)=O)=O)CO)=O)C)=O)C(C)C)=O |
| Sequence | Lys-Gly-Asn-Ser-Ala-Leu-His-Val-Ala-Ser-Gln-His-Gly-His-Leu-Gly-Cys-Ile-Gln-Thr-Leu-Val-Arg-Tyr-Gly-Ala-Asn-Val-Thr-Met-Gln-Asn-His-Gly |
| Sequence Short | KGNSALHVASQHGHLGCIQTLVRYGANVTMQNHG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.