Shopping Cart

Your shopping cart is currently empty

GLP-1(7-36), amide acetate

Name: GLP-1(7-36), amide acetate
Brand: TargetMol
SKU: TP1141
Price: 118 USD
Availability: InStock
Rating: 5 (10 reviews)

🥰Excellent

Catalog No. TP1141Cas No. 1119517-19-9

Alias Human GLP-1 (7-36), amide acetate, Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate

GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide (glucagon-like peptide-1).GLP-1(7-36), amide is able to activate the GLP-1 receptor, which has the ability to promote insulin secretion and inhibit glucagon secretion, with the potential to treat type 2 diabetes mellitus and obesity.

GLP-1(7-36), amide acetate

🥰Excellent

Purity: 99.89%

Catalog No. TP1141Alias Human GLP-1 (7-36), amide acetate, Glucagon-like peptide-1 (GLP-1)(7-36), amide acetateCas No. 1119517-19-9

Pack Size	Price	USA Warehouse	Global Warehouse
500 μg	$118	In Stock	In Stock
1 mg	$197	In Stock	In Stock
5 mg	$593	In Stock	In Stock
10 mg	$943	In Stock	In Stock
25 mg	$1,380	In Stock	In Stock
50 mg	$1,880	In Stock	In Stock
100 mg	$2,530	In Stock	In Stock

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Batch Information

Select Batch

Purity:99.89%

Appearance:Solid

Color:White

Resource Download

COA HPLC MS

Product Introduction

Bioactivity

Description	GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide (glucagon-like peptide-1).GLP-1(7-36), amide is able to activate the GLP-1 receptor, which has the ability to promote insulin secretion and inhibit glucagon secretion, with the potential to treat type 2 diabetes mellitus and obesity.
In vitro	Cells exposed to phorbol 12-myristate 13-acetate for 2 hours exhibited significantly enhanced GLP-1(7-36) levels compared to untreated controls. Similarly, glucose exposure augmented GLP-1 secretion in a dose-responsive manner. Fatty acids, including palmitic, oleic, linoleic, and linolenic acids, also elevated GLP-1 secretion dose-dependently, with unsaturated fatty acids (oleic, linoleic, and linolenic acids) proving more potent than saturated palmitic acid. Furthermore, treatment with CPE on NCI-H716 cells led to a dose-dependent increase in GLP-1 levels, with a notable 37% rise at 0.1% CPE concentration[1].
In vivo	Gastrointestinal administration of glucose increased active GLP-1(7-36), amide acetate levels in portal vein blood 10 minutes later, followed by a significant decrease in active GLP-1 levels 30 minutes later. TO active GLP-1 levels also increased 10 minutes after gastric administration, then decreased to basal levels at 60 minutes. [1]
Synonyms	Human GLP-1 (7-36), amide acetate, Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate

Chemical Properties

Molecular Weight	3357.68
Formula	C₁₅₁H₂₃₀N₄₀O₄₇
Cas No.	1119517-19-9
Smiles	C(C)(O)=O.C([C@@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@@H](CCCNC(=N)N)C(N)=O)=O)=O)CCCCN)=O)[C@@H](C)C)=O)CC(C)C)=O)NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](CC2=CC=C(O)C=C2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC3=CC=CC=C3)NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](CC4=CN=CN4)N)=O)C)=O)CCC(O)=O)=O)=O)[C@@H](C)O)=O)=O)[C@@H](C)O)=O)CO)=O)CC(O)=O)=O)C(C)C)=O)CO)=O)CO)=O)=O)CC(C)C)=O)CCC(O)=O)=O)=O)CCC(N)=O)=O)C)=O)C)=O)CCCCN)=O)CCC(O)=O)=O)=O)[C@H](CC)C)=O)C)=O)C=5C=6C(NC5)=CC=CC6
Relative Density.	no data available
Sequence	His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Sequence Short	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2

Storage & Solubility Information

Storage

keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

H2O: 80 mg/mL (23.83 mM), Sonication is recommended.

Solution Preparation Table

H2O

	1mg	5mg	10mg	50mg
1 mM	0.2978 mL	1.4891 mL	2.9782 mL	14.8912 mL
5 mM	0.0596 mL	0.2978 mL	0.5956 mL	2.9782 mL
10 mM	0.0298 mL	0.1489 mL	0.2978 mL	1.4891 mL
20 mM	0.0149 mL	0.0745 mL	0.1489 mL	0.7446 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc