Shopping Cart
Remove All
Your shopping cart is currently empty
Exendin derivative 1, a 39-amino acid peptide, is a chemical compound known for its significant biological activity and therapeutic potential.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $108 | Inquiry | Inquiry | |
| 5 mg | $216 | Inquiry | Inquiry | |
| 10 mg | $346 | Inquiry | Inquiry | |
| 25 mg | $742 | Inquiry | Inquiry |
| Description | Exendin derivative 1, a 39-amino acid peptide, is a chemical compound known for its significant biological activity and therapeutic potential. |
| Molecular Weight | 4187.56 |
| Formula | C184H281N49O61S |
| Relative Density. | no data available |
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser |
| Sequence Short | HAEGTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 50 mg/mL (11.94 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
| |||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.