Shopping Cart
- Remove All
- Your shopping cart is currently empty
Exendin derivative 1, a 39-amino acid peptide, is a chemical compound known for its significant biological activity and therapeutic potential.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $108 | Backorder | |
5 mg | $216 | Backorder | |
10 mg | $346 | Backorder | |
25 mg | $742 | Backorder |
Description | Exendin derivative 1, a 39-amino acid peptide, is a chemical compound known for its significant biological activity and therapeutic potential. |
Molecular Weight | 4187.56 |
Formula | C184H281N49O61S |
Relative Density. | no data available |
Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser |
Sequence Short | HAEGTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
Solubility Information | H2O: 50 mg/mL (11.94 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.