Shopping Cart
Remove All
Your shopping cart is currently empty
Peptide A5K acetate (INF7-A5K-TAT acetate) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold, designed to facilitate macromolecular transport in genome editing. Peptide A5K acetate non-covalently binds to CRISPR RNP (ribonucleoprotein complex) and delivers it into cells such as primary human T cells, B cells, and NK cells, enabling low-toxicity, multi-target, highly efficient, and precise genome editing.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $159 | - | In Stock | |
| 5 mg | $398 | - | In Stock | |
| 10 mg | $592 | - | In Stock | |
| 25 mg | $948 | - | In Stock | |
| 50 mg | $1,289 | - | In Stock | |
| 100 mg | $1,730 | - | In Stock |
| Description | Peptide A5K acetate (INF7-A5K-TAT acetate) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold, designed to facilitate macromolecular transport in genome editing. Peptide A5K acetate non-covalently binds to CRISPR RNP (ribonucleoprotein complex) and delivers it into cells such as primary human T cells, B cells, and NK cells, enabling low-toxicity, multi-target, highly efficient, and precise genome editing. |
| In vitro | Peptide A5K acetate possesses the capability to efficiently edit T cells without significantly affecting their viability [1]. |
| Synonyms | INF7-A5K-TAT acetate |
| Color | White |
| Appearance | Solid |
| Sequence | Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg |
| Sequence Short | GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.