Your shopping cart is currently empty

Peptide A5K acetate (INF7-A5K-TAT acetate) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold, designed to facilitate macromolecular transport in genome editing. Peptide A5K acetate non-covalently binds to CRISPR RNP (ribonucleoprotein complex) and delivers it into cells such as primary human T cells, B cells, and NK cells, enabling low-toxicity, multi-target, highly efficient, and precise genome editing.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $159 | - | In Stock | |
| 5 mg | $398 | - | In Stock | |
| 10 mg | $592 | - | In Stock | |
| 25 mg | $948 | - | In Stock | |
| 50 mg | $1,289 | - | In Stock | |
| 100 mg | $1,730 | - | In Stock |
| Description | Peptide A5K acetate (INF7-A5K-TAT acetate) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold, designed to facilitate macromolecular transport in genome editing. Peptide A5K acetate non-covalently binds to CRISPR RNP (ribonucleoprotein complex) and delivers it into cells such as primary human T cells, B cells, and NK cells, enabling low-toxicity, multi-target, highly efficient, and precise genome editing. |
| In vitro | Peptide A5K acetate possesses the capability to efficiently edit T cells without significantly affecting their viability [1]. |
| Synonyms | INF7-A5K-TAT acetate |
| Sequence | Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg |
| Sequence Short | GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.