Shopping Cart
- Remove All
- Your shopping cart is currently empty
Peptide A5K acetate, an INF7-TAT derivative, facilitates CRISPR RNP delivery to T cells and effectively enhances Cas9 RNP transport to natural killer (NK) cells [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $159 | 4-6 weeks | |
5 mg | $398 | 4-6 weeks | |
10 mg | $592 | 4-6 weeks | |
25 mg | $948 | 4-6 weeks | |
50 mg | $1,289 | 4-6 weeks | |
100 mg | $1,730 | 4-6 weeks |
Description | Peptide A5K acetate, an INF7-TAT derivative, facilitates CRISPR RNP delivery to T cells and effectively enhances Cas9 RNP transport to natural killer (NK) cells [1]. |
Sequence | Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg |
Sequence Short | GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.