Shopping Cart
- Remove All
- Your shopping cart is currently empty
Oxyntomodulin (human, mouse, rat) (Proglucagon [33-69]) is a 37-amino acid derivative of the glucagon progenitor that includes the entire glucagon sequence plus an additional C-terminal octapeptide.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Oxyntomodulin (human, mouse, rat) (Proglucagon [33-69]) is a 37-amino acid derivative of the glucagon progenitor that includes the entire glucagon sequence plus an additional C-terminal octapeptide. |
Synonyms | Proglucagon (33-69) |
Cas No. | 159002-68-3 |
Sequence | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala |
Sequence Short | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.