app

δ-secretase inhibitor 11 is an inhibitor of δ-secretase and can be used as a lead compound for translational development of AD treatment.

APP-FUBINACA is a cannabinoid receptor agonist, classified as a phenylalanine amide-based indazole-3-carboxamide derivative. It exhibits neurostimulatory effects.

APP-018 (D-4F) is an 18 D-amino acid peptide that mimics apolipoprotein A-I (apoA-I). It enhances the anti-inflammatory properties of high-density lipoprotein (HDL) and is applicable in cardiovascular disease research.

Human IgG1 kappa, Isotype Control is a humanized IgG-like monoclonal antibody and an isotype control antibody for human IgG1κ.

Lappaconitine ((+)-Lappaconitine), isolated from Aconitum sinomontanum Nakai, was characterized as an analgesic.

1. Protosappanin B (Q-100961) significantly increases cell viability, inhibits cell apoptosis and up-regulates the expression of growth-associated protein 43. 2. Protosappanin B induces the degradation of p53 protein, via activation of a MDM2-dependent ubiquitination process.

Pep-1 (uncapped), which has 21 amino acid residues, is a known carrier peptide that delivers full-length native proteins in vitro and in vivo.

Sappanol is a useful organic compound for research related to life sciences and the catalog number is T126391.

Amylin (IAPP), feline is the peptide subunit of amyloid found in pancreatic islets of type 2 diabetic patients and in insulinomas.

Sappanone B is a useful organic compound for research related to life sciences and the catalog number is T126481.

'3'-Deoxy-4-O-methylsappanol exhibits moderate cytotoxicity against cultured human melanoma HMV-II cells, with an IC50 value of 872.0 µM ± [2.4].

DMAPP, also known as Dimethylallyl pyrophosphate, is an isoprenoid precursor found in all life forms. It serves as an isomer of isopentenyl pyrophosphate (IPP).

3'-Deoxy-4-O-methylepisappanol is a useful organic compound for research related to life sciences and the catalog number is T126471.

Cappariloside A is a natural product that can be used in related research in the field of life sciences. Its product number is TN8647.

Appenolide A is an antifungal furanone that can be isolated from the coprophilous fungus Podospora appendiculata.

10-O-Methylprotosappanin B, a natural product of Caesalpinia (Fabaceae), has the catalog number TN5673 and the CAS number 111830-77-4. It can be used as a reference standard.

Episappanol has anti-inflammatory activity , it can significantly inhibit the secretion of the pro-inflammatory cytokines interleukin (IL-6) and tumor necrosis factor-alpha (TNF-α).

Isolappaol A, with catalog number TN6461 and CAS number 131400-96-9, is a natural product utilized for life sciences research.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

APPA, an aldose reductase inhibitor, demonstrates efficacy in preventing apoptosis and symptoms of Streptozotocin-induced diabetes in rats through inhibition of the polyol pathway. This compound shows promise for research into diabetic nephropathy (DN) [1].

NEP(1-40), N-terminal uncapped, is an analog of NEP(1-40) without acetylation at the N-terminus. NEP(1-40) acts as a peptide antagonist of the Nogo-66 receptor (NgR).

Sappanone A is a high isoflavanone that exhibits anti-inflammatory effects by modulating Nrf2.Sappanone A attenuates allergic airway inflammation in ovalbumin-induced asthma.

Human IgG4 kappa Isotype Control is a monoclonal antibody serving as an isotype control for the human IgG4κ antibody [1].

Human IgG1 (D265A) kappa Isotype Control is a chimeric monoclonal antibody derived from both human and mouse, designed to serve as an isotype control for the human IgG1 (D265A)κ antibody.