PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His)

Name: PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His)
Brand: TargetMol
SKU: TMPH-04804
Rating: 4.5 (1 reviews)

(Synonyms: PPAR-alpha, PPARA, PPAR, Peroxisome proliferator-activated receptor alpha, Nuclear receptor subfamily 1 group C member 1, NR1C1) Copy Product Info

Synonyms: PPAR-alpha, PPARA, PPAR, Peroxisome proliferator-activated receptor alpha, Nuclear receptor subfamily 1 group C member 1, NR1C1

Catalog No. TMPH-04804 Copy Product Info

PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His) is expressed in Baculovirus Insect Cells. The accession number is Q07869.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$178	20 days	20 days
10 μg	$295	20 days	20 days
20 μg	$472	20 days	20 days
50 μg	$780	20 days	20 days
100 μg	$1,320	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His) is expressed in Baculovirus Insect Cells. The accession number is Q07869.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	Q07869
Amino Acid	MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Construction	1-468 aa
Protein Purity	> 85% as determined by SDS-PAGE
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	PPAR-alpha, PPARA, PPAR, Peroxisome proliferator-activated receptor alpha, Nuclear receptor subfamily 1 group C member 1, NR1C1
Research Background

Chemical Properties

Molecular Weight

56.2 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His) chemical structure | PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His) molecular weight