Shopping Cart
Remove All
Your shopping cart is currently empty
PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His)
Catalog No. TMPH-04804
PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His) is expressed in Baculovirus Insect Cells. The accession number is Q07869.
PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His)
Catalog No. TMPH-04804
PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His) is expressed in Baculovirus Insect Cells. The accession number is Q07869.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $178 | 20 days | 20 days | |
| 10 μg | $295 | 20 days | 20 days | |
| 20 μg | $472 | 20 days | 20 days | |
| 50 μg | $780 | 20 days | 20 days | |
| 100 μg | $1,320 | 20 days | 20 days |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | PPAR alpha/PPARA Protein, Human, Recombinant (aa 1-468, His) is expressed in Baculovirus Insect Cells. The accession number is Q07869. |
| Species | Human |
| Expression System | Baculovirus Insect Cells |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q07869 |
| Synonyms | PPAR-alpha,PPARA,PPAR,Peroxisome proliferator-activated receptor alpha,Nuclear receptor subfamily 1 group C member 1,NR1C1 |
| Amino Acid | MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY |
| Construction | 1-468 aa |
| Protein Purity | > 85% as determined by SDS-PAGE |
| Molecular Weight | 56.2 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16 |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.