GSTK1 Protein, Human, Recombinant (GST)

Catalog No. TMPH-01396

Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3.

GSTK1 Protein, Human, Recombinant (GST)

Catalog No. TMPH-01396

Pack Size	Price	Availability
20 μg	$196	20 days
100 μg	$397	20 days
1 mg	$1,760	20 days

Bulk & Custom

Add to Cart

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 μg/mL can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng/mL.
Description	Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	Q9Y2Q3
Synonyms	GSTK1-1 (hGSTK1),GSTK1,GST class-kappa,GST 13-13,Glutathione S-transferase subunit 13,Glutathione S-transferase kappa 1
Amino Acid	GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Construction	2-226 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	52.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris/PBS-based buffer
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).