Shopping Cart
Remove All
Your shopping cart is currently empty
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $74 | 20 days | 20 days | |
| 10 μg | $119 | 20 days | 20 days | |
| 20 μg | $196 | 20 days | 20 days | |
| 50 μg | $292 | 20 days | 20 days | |
| 100 μg | $397 | 20 days | 20 days | |
| 200 μg | $618 | 20 days | 20 days | |
| 500 μg | $1,120 | 20 days | 20 days | |
| 1 mg | $1,760 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 μg/mL can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng/mL. |
| Description | Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-GST |
| Accession Number | Q9Y2Q3 |
| Synonyms | GSTK1-1 (hGSTK1),GSTK1,GST class-kappa,GST 13-13,Glutathione S-transferase subunit 13,Glutathione S-transferase kappa 1 |
| Amino Acid | GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL |
| Construction | 2-226 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 52.4 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris/PBS-based buffer |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.