Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

GSTK1 Protein, Human, Recombinant (GST)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01396

Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3.

GSTK1 Protein, Human, Recombinant (GST)

GSTK1 Protein, Human, Recombinant (GST)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01396
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$7420 days20 days
10 μg$11920 days20 days
20 μg$19620 days20 days
50 μg$29220 days20 days
100 μg$39720 days20 days
200 μg$61820 days20 days
500 μg$1,12020 days20 days
1 mg$1,76020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 μg/mL can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng/mL.
Description
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3.
Species
Human
Expression System
E. coli
TagN-GST
Accession NumberQ9Y2Q3
Synonyms
GSTK1-1 (hGSTK1),GSTK1,GST class-kappa,GST 13-13,Glutathione S-transferase subunit 13,Glutathione S-transferase kappa 1
Amino Acid
GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Construction
2-226 aa
Protein Purity
> 90% as determined by SDS-PAGE.
GSTK1 Protein, Human, Recombinant (GST)
Molecular Weight52.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris/PBS-based buffer
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords