GSTK1 Protein, Human, Recombinant (GST)

Name: GSTK1 Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-01396
Rating: 4.5 (1 reviews)

(Synonyms: GSTK1-1 (hGSTK1), GSTK1, GST class-kappa, GST 13-13, Glutathione S-transferase subunit 13, Glutathione S-transferase kappa 1) Copy Product Info

Synonyms: GSTK1-1 (hGSTK1), GSTK1, GST class-kappa, GST 13-13, Glutathione S-transferase subunit 13, Glutathione S-transferase kappa 1

Catalog No. TMPH-01396 Copy Product Info

Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3.

Pack Size	Price	USA Stock	Global Stock
5 µg	$74	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$196	20 days	20 days
50 µg	$292	20 days	20 days
100 µg	$397	20 days	20 days
200 µg	$618	20 days	20 days
500 µg	$1,120	20 days	20 days
1 mg	$1,760	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 μg/mL can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng/mL.
Description	Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). GSTK1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 52.4 kDa and the accession number is Q9Y2Q3.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	Q9Y2Q3
Amino Acid	GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Construction	2-226 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris/PBS-based buffer
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	GSTK1-1 (hGSTK1), GSTK1, GST class-kappa, GST 13-13, Glutathione S-transferase subunit 13, Glutathione S-transferase kappa 1
Research Background	Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).

Chemical Properties

Molecular Weight

52.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.