Shopping Cart
- Remove All
- Your shopping cart is currently empty
Amylin (IAPP), feline TFA, a 37-amino acid polypeptide derived from felines, is a principal secretion product of the pancreatic islets' β-cells. This regulatory peptide notably inhibits the secretion of insulin and glucagon [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Amylin (IAPP), feline TFA, a 37-amino acid polypeptide derived from felines, is a principal secretion product of the pancreatic islets' β-cells. This regulatory peptide notably inhibits the secretion of insulin and glucagon [1]. |
Molecular Weight | 4024.47 |
Formula | C167H271F3N52O56S2 |
Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7) |
Sequence Short | KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.