Shopping Cart
- Remove All
Your shopping cart is currently empty
VSTx-3 is a potassium voltage-gated channel (K_V) blocker, which has also been shown to be a potent tetrodotoxin-sensitive (TTX-sensitive) sodium channel inhibitor, with particular efficacy against NaV1.8 channels, as evidenced by its half-maximal inhibitory concentration (IC_50) values of 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7, and 0.77 μM for hNaV1.8 channels.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | VSTx-3 is a potassium voltage-gated channel (K_V) blocker, which has also been shown to be a potent tetrodotoxin-sensitive (TTX-sensitive) sodium channel inhibitor, with particular efficacy against NaV1.8 channels, as evidenced by its half-maximal inhibitory concentration (IC_50) values of 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7, and 0.77 μM for hNaV1.8 channels. |
| Synonyms | κ-Theraphotoxin-Gr4a, Voltage sensor toxin 3, Peptide F, Kappa-TRTX-Gr4a |
| Sequence | Asp-Cys-Leu-Gly-Trp-Phe-Lys-Gly-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Tyr-Lys-Cys-Asn-Arg-Arg-Asp-Lys-Trp-Cys-Lys-Tyr-Lys-Leu-Trp (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29) |
| Sequence Short | DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.