key

Dexamethasone acetate (NSC 39471) is the acetate salt form of Dexamethasone, a synthetic adrenal corticosteroid with potent anti-inflammatory properties. In addition to binding to specific nuclear steroid receptors, dexamethasone also interferes with NF-kB activation and apoptotic pathways. This agent lacks the salt-retaining properties of other related adrenal hormones.

Parkeyl acetate is a bioactive chemical.

Cyclic MKEY TFA, a synthetic cyclic peptide, inhibits CXCL4-CCL5 heterodimer formation, thus guarding against atherosclerosis and aortic aneurysm by mitigating inflammation. Additionally, it affords protection against stroke-induced brain injury in mice [1] [2].

Anti-Monkey/Human MDR-1/CD243 Antibody (UIC2) is an IgG2a, κ monoclonal antibody derived from mice, designed to inhibit MDR-1/CD243 proteins in monkeys or humans.

Anti-Monkey/Human MHC class II (HLA-DR) Antibody (L243) is an IgG2a, κ antibody inhibitor derived from mice that targets monkey or human MHC class II.

MKEY, a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, has been shown to protect against atherosclerosis and aortic aneurysm formation by mediating inflammation, but whether it modulates neuroinflammation and brain injury has not

GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2.

Keyhole Limpet Hemocyanin-FITC can induce both T cell-dependent and non-T cell-dependent immune responses.

Type II Collagen ( from Monkey) is a T cell-dependent antigen with unique immunological characteristics, used as a stimulating antigen in in vitro culture systems.

MacConkey Agar (MAC) is used for the selective isolation of enteric pathogens. The composition for 1 liter of MacConkey Agar includes: peptone (20.0 g), lactose (10.0 g), bile salts No. 3 (1.5 g), sodium chloride (5.0 g), neutral red (0.03 g), crystal violet (0.001 g), and agar (15.0 g).

MIV-247 is a selective and potent inhibitor of cathepsin S (Kis 2.1, 4.2, and 7.5 nM for human, mouse, and wild monkey cathepsin S, respectively), which attenuates mechanical anomalies in preclinical models of neuropathic pain, and can be used to study cardiac muscle injury.

BI-135585 is an orally active, selective and potent inhibitor of human 11β-hydroxysteroid dehydrogenase-1 (HSD1) for the study of type 2 diabetes.

JBSNF-000028 is an orally active and potent nicotinamide N-methyltransferase (NNMT) inhibitor with inhibitory effects on human NNMT (hNNMT), monkey NNMT (mkNNMT), and mouse NNMT (mNNMT) with IC50s of 0.033 μM, 0.19 μM, and 0.21 μM, respectively.JBSNF-000028 can drive insulin sensitization and weight loss. 000028 drives insulin sensitization, glucose regulation and weight loss and can be used to study metabolic disorders.

Chrysophanol (Turkey Rhubarb) is an EGFR/mTOR pathway inhibitor, which can be found in rhubarb, and sorrel.

JBSNF-000088 is an Nicotinamide N-methyltransferase (NNMT)inhibitor. It is used for the treatment of metabolic disorders.

Dersimelagon (MT-7117) is an orally active, selective melanocortin 1 receptor (MC1R) agonist with EC50 values ​​of 8.16, 3.91, 1.14, and 0.251 nM for human (h), cynomolgus monkey (cm), mouse (m), and rat (r) MC1R, respectively. Dersimelagon exhibits good affinity for hMC1R and hMC4R, with Ki values ​​of 2.26 and 32.9 nM, respectively. Dersimelagon can be used in the study of skin pigmentation[1].

JNJ-39758979 is a selective and high-affinity histamine H4 receptor antagonist (Kis: 12.5, 5.3, and 25 nM for human, mouse, and monkey histamine H4 receptor, respectively). JNJ-39758979 functionally antagonizes histamine-induced cAMP inhibition with a pA2

Rolapitant, also known as SCH-619734, is an orally bioavailable, centrally-acting, selective, neurokinin 1 receptor (NK1-receptor) antagonist with potential antiemetic activity. Upon oral administration, rolapitant competitively binds to and blocks the activity of the NK1-receptor in the central nervous system, thereby inhibiting the binding of the endogenous ligand, substance P (SP). This may prevent both SP-induced emesis and chemotherapy-induced nausea and vomiting (CINV). The interaction of SP with the NK1-receptor plays a key role in the induction of nausea and vomiting caused by emetogenic cancer chemotherapy.

BAY-298 is an orally active and selective luteinizing hormone receptor (LH-R) antagonist with IC50s of 96 nM, 23 nM, and 78 nM for hLH (human LH), rLH (rat LH), and cLH (cynomolgus monkey LH), respectively. It is the first nanomolar hLH-R antagonist that reduces sex hormone levels in vivo [1].

CCR6 inhibitor 1 is an effective and selective inhibitor of CCR6 (IC50 of monkey and human CCR6 was 0.45 nM and 6 nM, respectively). CCR6 is associated with both autoimmune and non-autoimmune diseases, so CCR6 inhibitor 1 is useful for in vitro and in vivo pathophysiology studies as a small molecule inhibitor of CCR6.

Forodesine hydrochloride (BCX-1777 hydrochloride), a potent inhibitor of human lymphocyte proliferation, effectively induces apoptosis in leukemic cells by elevating dGTP levels. This compound is an orally active, highly potent purine nucleoside phosphorylase (PNP) inhibitor, demonstrating IC50 values between 0.48 to 1.57 nM across human, mouse, rat, monkey, and dog PNP.

SB-657510 is a urotensin II (UII) receptor (UT) antagonist. The Ki values of UT for human, monkey, cat, rat and mouse were 61, 17, 30, 65 and 56 nM, respectively. SB-657510 plays an anti-inflammatory role by inhibiting UII-induced inflammatory mediators, such as adhesion molecules, in human vascular endothelial cells and upregulation of cytokines and tissue factors. SB 657510 has a therapeutic effect on diabetes-related atherosclerotic disease in diabetic mouse models.

TAK-024 is an inhibitor of platelet(IC50s of 31, 79 and 51 nM in human, monkey and guinea pig, respectively).

FCE 28654 is a water-soluble acyl-CoA inhibitor.