key

Dexamethasone acetate (NSC 39471) is the acetate salt form of Dexamethasone, a synthetic adrenal corticosteroid with potent anti-inflammatory properties. In addition to binding to specific nuclear steroid receptors, dexamethasone also interferes with NF-kB activation and apoptotic pathways. This agent lacks the salt-retaining properties of other related adrenal hormones.

Parkeyl acetate is a bioactive chemical.

Cyclic MKEY TFA, a synthetic cyclic peptide, inhibits CXCL4-CCL5 heterodimer formation, thus guarding against atherosclerosis and aortic aneurysm by mitigating inflammation. Additionally, it affords protection against stroke-induced brain injury in mice [1] [2].

Anti-Mouse/Rat/Monkey/Human ICOS/CD278 Antibody (C398.4A) is an IgG antibody inhibitor derived from American hamster, targeting ICOS/CD278 in mice, rats, monkeys, and humans.

Anti-Monkey/Human MDR-1/CD243 Antibody (UIC2) is an IgG2a, κ monoclonal antibody derived from mice, designed to inhibit MDR-1/CD243 proteins in monkeys or humans.

Anti-Monkey/HumanCD28Antibody (CD28.2) is a mouse-derived IgG1, κ antibody inhibitor targeting monkey or human CD28.

Anti-Monkey/Human CD20 Antibody (2H7) is a mouse-derived IgG2b, κ antibody inhibitor targeting CD20 in monkeys and humans.

Anti-Monkey/Human CD40L/CD154 Antibody (5C8) is an IgG2a inhibitor derived from mice that targets CD40L/CD154 in monkeys and humans.

Anti-Mouse/Human/Rat/Monkey/Hamster/Canine/Bovine TGF-β Antibody (1D11.16.8) is an IgG antibody inhibitor targeting TGF-β in multiple species including mouse, human, rabbit, monkey, hamster, dog, and cow. For information on the isotype control, refer to Mouse IgG1 kappa, Isotype Control.

Anti-Monkey/Human MHC class II (HLA-DR) Antibody (L243) is an IgG2a, κ antibody inhibitor derived from mice that targets monkey or human MHC class II.

Rat IgG2b isotype control, Anti-keyhole limpet hemocyanin is rat IgG2b isotype control, anti-keyhole limpet hemocyanin.

MKEY, a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, has been shown to protect against atherosclerosis and aortic aneurysm formation by mediating inflammation, but whether it modulates neuroinflammation and brain injury has not

GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2.

Keyhole Limpet Hemocyanin-FITC can induce both T cell-dependent and non-T cell-dependent immune responses.

Type II Collagen ( from Monkey) is a T cell-dependent antigen with unique immunological characteristics, used as a stimulating antigen in in vitro culture systems.

MacConkey Agar (MAC) is used for the selective isolation of enteric pathogens. The composition for 1 liter of MacConkey Agar includes: peptone (20.0 g), lactose (10.0 g), bile salts No. 3 (1.5 g), sodium chloride (5.0 g), neutral red (0.03 g), crystal violet (0.001 g), and agar (15.0 g).

1-PeCSO is isolated from onion or garlic bulbs. It acts as a key compound in garlic greening and reacts with lachrymatory factor synthase.

L-Cystathionine (Cystathionine, L-) is a key nonprotein amino acid related to metabolic conditions of sulfur-containing amino acids. L-Cystathionine can be used in studies about cardiovascular protection.

MU1656 is a potent and selective inhibitor of histone methyltransferase DOT1L (IC50 = 2 nM), a key epigenetic regulatory protein involved in the development of cancers such as hematologic malignancies, thus MU1656 was able to significantly inhibit the proliferation of cancer cells and induce apoptosis.

LKM38, a novel diazolidinyl cholesterol probe, is a promising cholesterol mimetic.LKM38 both maintains cholesterol-resistant cell growth and appropriately regulates key cholesterol homeostatic pathways.LKM38 can be a powerful tool for studying cholesterol protein interactions and trafficking.

Navamepent (RX-10045) is an analog of resolvin E1 (a dietary-3 polyunsaturated fatty acid metabolite), which has potent anti-inflammatory activity that reduces corneal inflammation, epithelial damage, and accelerates corneal tissue repair.Navamepent inhibits the release of several key pro-inflammatory mediators from corneal epithelial cells.Navamepent is very effective against dry eye and cupping cell loss Navamepent is effective against dry eye and cupping cell loss, and accelerates tear production.

2-Acetyl-6-methoxynaphthalene, the key intermediate of naphthalene tome and naproxen, is used in synthetic non-steroidal anti-inflammatory analgesic medicine and.

Cholesterol is the primary sterol in mammals, accounting for approximately 20–25% of the plasma membrane structure. It plays a key role in regulating membrane fluidity, permeability, and protein function. As an endogenous agonist of estrogen-related receptor α (ERRα), cholesterol is widely involved in metabolic regulation and serves as a precursor for the synthesis of hormones and bile acids. It is commonly used in experimental models of hyperlipidemia.

Rofecoxib (MK 966) binds to and inhibits the enzyme cyclooxygenase-2 (COX-2), resulting in an inhibition of the conversion of arachidonic acid to prostaglandins. Rofecoxib is a synthetic, nonsteroidal derivative of phenyl-furanone with anti-inflammatory, antipyretic and analgesic properties and potential antineoplastic properties. COX-related metabolic pathways may represent key regulators of cell proliferation and neo-angiogenesis. Some epithelial tumor cell types overexpress pro-angiogenic COX-2.