SCN1A Protein, Human, Recombinant (His)

Name: SCN1A Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02118
Rating: 4.5 (1 reviews)

(Synonyms: Voltage-gated sodium channel subunit alpha Nav1.1, Sodium channel protein type I subunit alpha, Sodium channel protein type 1 subunit alpha, Sodium channel protein brain I subunit alpha, SCN1A, SCN1, NAC1) Copy Product Info

Synonyms: Voltage-gated sodium channel subunit alpha Nav1.1, Sodium channel protein type I subunit alpha, Sodium channel protein type 1 subunit alpha, Sodium channel protein brain I subunit alpha, SCN1A, SCN1, NAC1

Catalog No. TMPH-02118 Copy Product Info

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. Plays a key role in brain, probably by regulating the moment when neurotransmitters are released in neurons. Involved in sensory perception of mechanical pain: activation in somatosensory neurons induces pain without neurogenic inflammation and produces hypersensitivity to mechanical, but not thermal stimuli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity
Description	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. Plays a key role in brain, probably by regulating the moment when neurotransmitters are released in neurons. Involved in sensory perception of mechanical pain: activation in somatosensory neurons induces pain without neurogenic inflammation and produces hypersensitivity to mechanical, but not thermal stimuli.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P35498
Amino Acid	MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS
Construction	1-128 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Voltage-gated sodium channel subunit alpha Nav1.1, Sodium channel protein type I subunit alpha, Sodium channel protein type 1 subunit alpha, Sodium channel protein brain I subunit alpha, SCN1A, SCN1, NAC1
Research Background

Chemical Properties

Molecular Weight

18.5 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Voltage-gated sodium channel subunit α Nav1.1Voltage-gated sodium channel subunit a Nav1.1Sodium channel protein type I subunit αSodium channel protein type I subunit aSodium channel protein type 1 subunit αSodium channel protein type 1 subunit aSodium channel protein brain I subunit αSodium channel protein brain I subunit aSCN 1NAC 1

Related Tags: SCN1A Protein, Human, Recombinant (His) chemical structure | SCN1A Protein, Human, Recombinant (His) molecular weight