Home Tools
Log in
Cart

nifH1 Protein, Methanobacterium ivanovii, Recombinant (His & Myc)

Catalog No. TMPH-02460

The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein. nifH1 Protein, Methanobacterium ivanovii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 37.4 kDa and the accession number is P51602.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
nifH1 Protein, Methanobacterium ivanovii, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein. nifH1 Protein, Methanobacterium ivanovii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 37.4 kDa and the accession number is P51602.
Species Methanobacterium ivanovii
Expression System E. coli
Tag N-10xHis, C-Myc
Accession Number P51602
Amino Acid MVRKIAIYGKGGIGKSTTTQNTASAMAHFHNQRVMIHGCDPKADSTRMILGGKMQTTMMDTLREEGEEACMDLDNVMSTGFKDIKCVESGGPEPGVGCAGRGVITAITIMEHMKVYDDNDFVFFDVLGDVVCGGFAMPIRDGKAEEIYIVASGEMMALYAANNLCKGMVKYAEQSGVRLGGIICNSRNVDGEKELLEEFCKRIGTQMIHFVPRDNIVQKAEFNKRTVVDFDAECSQAHEYSELARKIIENDNFVIPDPMTMDELEEMVVSYGLMD
Construction 1-275 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 37.4 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol