Shopping Cart
- Remove All
- Your shopping cart is currently empty
GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | Inquiry | 10-14 weeks | |
5 mg | Inquiry | 10-14 weeks |
Description | GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2. |
Molecular Weight | 3327.61 |
Formula | C149H224N40O47 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice./Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.