Shopping Cart
Remove All
Your shopping cart is currently empty
β-Amyloid (42-1), human is the inactive form of amyloid β peptide (1-42), consisting of 42 amino acids. It plays a key role in the pathogenesis of Alzheimer's disease and is commonly used to induce Alzheimer's disease models.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $240 | Inquiry | Inquiry |
| Description | β-Amyloid (42-1), human is the inactive form of amyloid β peptide (1-42), consisting of 42 amino acids. It plays a key role in the pathogenesis of Alzheimer's disease and is commonly used to induce Alzheimer's disease models. |
| Synonyms | Amyloid β Peptide (42-1)(human) |
| Molecular Weight | 4514.04 |
| Formula | C203H311N55O60S |
| Cas No. | 317366-82-8 |
| Relative Density. | no data available |
| Sequence | Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp |
| Sequence Short | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| Storage | keep away from moisture | Powder: -20°C for 3 years | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 0.5 mg/mL (0.11 mM), Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.