Shopping Cart
- Remove All
- Your shopping cart is currently empty
β-Amyloid (42-1), human, is the inactive form of Amyloid β Peptide (1-42), which plays a pivotal role in the pathogenesis of Alzheimer's disease.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $243 | Backorder |
Description | β-Amyloid (42-1), human, is the inactive form of Amyloid β Peptide (1-42), which plays a pivotal role in the pathogenesis of Alzheimer's disease. |
Alias | Amyloid β Peptide (42-1)(human) |
Molecular Weight | 4514.04 |
Formula | C203H311N55O60S |
Cas No. | 317366-82-8 |
Relative Density. | no data available |
Sequence | Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp |
Sequence Short | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Solubility Information | H2O: 0.5 mg/mL (0.11 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.