Shopping Cart
- Remove All
- Your shopping cart is currently empty
β-Amyloid (42-1), human TFA, a 42-amino acid peptide, represents the inactive form of Amyloid β Peptide (1-42) and is crucial in the development of Alzheimer's disease [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | β-Amyloid (42-1), human TFA, a 42-amino acid peptide, represents the inactive form of Amyloid β Peptide (1-42) and is crucial in the development of Alzheimer's disease [1]. |
Sequence Short | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.