Shopping Cart
- Remove All
- Your shopping cart is currently empty
Acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body\'s salt and water balance. Improves heart function.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $319 | Backorder | |
5 mg | $918 | Backorder |
Description | Acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body\'s salt and water balance. Improves heart function. |
Synonyms | Brain Natriuretic Peptide (BNP) (1-32), rat TFA, BNP (1-32), rat TFA |
Molecular Weight | 3566.96 |
Formula | C146H239N47O44S3.C2HF3O2 |
Relative Density. | no data available |
Sequence Short | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRX |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.