Shopping Cart
Remove All
Your shopping cart is currently empty
Acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body\'s salt and water balance. Improves heart function.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $319 | Inquiry | Inquiry | |
| 5 mg | $918 | Inquiry | Inquiry |
| Description | Acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body\'s salt and water balance. Improves heart function. |
| Synonyms | Brain Natriuretic Peptide (BNP) (1-32), rat TFA, BNP (1-32), rat TFA |
| Molecular Weight | 3566.96 |
| Formula | C146H239N47O44S3.C2HF3O2 |
| Relative Density. | no data available |
| Sequence Short | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRX |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.