Shopping Cart
Remove All
Your shopping cart is currently empty
β-Amyloid (1-40), HFIP-treated, refers to the β-Amyloid (1-40) peptide that has been processed with HFIP. This peptide is a key protein fragment found in the brain plaques of individuals with Alzheimer's disease.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | β-Amyloid (1-40), HFIP-treated, refers to the β-Amyloid (1-40) peptide that has been processed with HFIP. This peptide is a key protein fragment found in the brain plaques of individuals with Alzheimer's disease. |
| In vivo | Before conducting formal experiments, it is advisable to determine optimal conditions (such as animal strain, age, dosage, frequency, duration, test times, and parameters) through preliminary tests. β-Amyloid (1-40) can be utilized in animal models to develop Alzheimer's disease models. The pathogenic mechanism involves β-Amyloid (1-40) accumulating in the brain with neurotoxic properties, thereby inducing Alzheimer's disease. Specific modeling method: Rats: Wistar • Male • 280-320 g Administration: 0, 3, 30, 300 pmol • Infusion using a cannula attached to a modified micro-osmotic pump • Duration: 2 weeks. Note: (1) Dissolve β-Amyloid (1-40) in 35% acetonitrile/0.1% trifluoroacetic acid (TFA). (2) Each group consists of 7 rats. On Day 1, insert the catheter into the left ventricle. Conduct the water maze task between days 9 and 13 after infusion begins. Post-behavioral experiments, decapitate 4 rats per group to measure ChAT activity, and use 3 rats for histochemical analysis. (3) For histochemical studies, anesthetize rats and euthanize them via transaortic perfusion fixation using cold saline followed by 4% paraformaldehyde and 0.1 M phosphate buffer. Extract and fix brains in the same fixative for 12 hours. Slice frozen brain tissue at 20 μm using a cryostat, collecting the periventricular region. Indicators of successful modeling include molecular changes: decreased acetylcholine transferase (ChAT) activity in the frontal cortex and hippocampus, leading to cholinergic neuron dysfunction; tissue changes: β-Amyloid accumulation in the hippocampus and cerebral cortex; and phenotypic observation: memory impairment. |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Sequence Short | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.