Shopping Cart
- Remove All
- Your shopping cart is currently empty
Amyloid β Peptide (42-1)(human) acetate is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1)(human) acetate is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $162 | In Stock | |
5 mg | $375 | In Stock | |
10 mg | $562 | In Stock | |
25 mg | $828 | In Stock | |
50 mg | $1,130 | In Stock | |
100 mg | $1,530 | In Stock |
Description | Amyloid β Peptide (42-1)(human) acetate is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1)(human) acetate is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease. |
Synonyms | Amyloid β Peptide (42-1)(human) acetate(317366-82-8 free base) |
Relative Density. | no data available |
Sequence | Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp |
Sequence Short | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | DMSO: 20 mg/mL, Sonication is recommended. ![]() |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.