Shopping Cart
Remove All
Your shopping cart is currently empty
Titin Protein, Human, Recombinant (Isoform 6, His)
(Synonyms: TTN, Titin, Rhabdomyosarcoma antigen MU-RMS-40.14, Connectin) Copy Product InfoSynonyms: TTN, Titin, Rhabdomyosarcoma antigen MU-RMS-40.14, Connectin
Catalog No. TMPH-02205 Copy Product Info
Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $89 | 20 days | 20 days | |
| 10 μg | $143 | 20 days | 20 days | |
| 20 μg | $237 | 20 days | 20 days | |
| 50 μg | $358 | 20 days | 20 days | |
| 100 μg | $490 | 20 days | 20 days | |
| 200 μg | $755 | 20 days | 20 days | |
| 500 μg | $1,330 | 20 days | 20 days | |
| 1 mg | $2,080 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:90%
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q8WZ42-6 |
| Amino Acid | VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT |
| Construction | 5398-5604 aa |
| Protein Purity | > 90% as determined by SDS-PAGE.  |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | TTN, Titin, Rhabdomyosarcoma antigen MU-RMS-40.14, Connectin |
| Research Background |
| Molecular Weight | 26.5 kDa (predicted) |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: Titin Protein, Human, Recombinant (Isoform 6, His) chemical structure | Titin Protein, Human, Recombinant (Isoform 6, His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.