Home Tools
Log in
Products Inhibitors Libraries Recombinant Proteins Kits Services Contact Us
Cart
Peptides Monoclonal Antibodies Dye Reagents PROTAC Virtual Screening TargetMol Kits Cell Counting Kit-8 (CCK-8) Inhibitor Cocktails Natural Products Phenols Alkaloids Flavonoids
Inhibitors Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK
Membrane transporter/Ion channel Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Compound Libraries Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD Drug-like Compound Libraries Fragment Libraries Custom Compound Library
Signaling Pathways Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling
DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK Membrane transporter/Ion channel
Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome
Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries
Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD
Drug-like Compound Libraries Compound Libraries for HTS/HCS
Fragment Libraries General Fragment Libraries Characteristic Fragment Libraries Custom Compound Library
TargetMol
Cytokines and Growth Factors •   Cytokines •   Growth Factors Receptor Proteins •   Fc Receptors •   Cytokines and Growth Factor Receptors
CD Proteins •   T Cell CD Proteins •   B Cell CD Proteins Immune Checkpoint Proteins •   Co-inhibitory Immune Checkpoint Proteins •   Co-stimulatory Immune Checkpoint Proteins
CAR-T Therapy Target Proteins •   Hematologic Malignancies Target Proteins •   Solid Tumors Target Proteins Enzymes •   Oxidoreductases,EC 1 •   Transferases,EC 2
Viral Proteins •   Coronavirus (CoV) Proteins •   Influenza Proteins Fluorescent Proteins Others

MELK Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01642

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
MELK Protein, Human, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.
Species Human
Expression System E. coli
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number Q14680
Amino Acid MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-340 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 44.3 kDa as predicted
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

CORPORATE
About Us Careers Privacy Notice Events & News Terms & Conditions
SUPPORT
Contact Us Worldwide Distributors Quality Control Technical Support
RESOURCE
Product Catalog Product Citations Signaling Pathways Solution Calculators
FOLLOW OUR
Social Network
Newsletter Subscription
Subscribe to receive our lastest product updates and special offers!
Corporate
Support
Resource
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
TargetMol
Copyright © 2015-2024 TargetMol Chemicals Inc. All rights reserved.