Shopping Cart
- Remove All
- Your shopping cart is currently empty
Anpocogin, a variant of the Ancyclostoma canium nematode anticoagulant protein c2 with an added C-terminal P85, is synthesized in Pichia pastoris and functions as an anticoagulant agent [1].Recombinant nematode anticoagulant protein c2 (rNAPc2) is a potent inhibitor of serine protease factor VIIa and its cell-associated cofactor tissue factor FVIIa/TF, a key physiological initiator of blood coagulation, with potential efficacy in the treatment of disseminated intravascular coagulopathy and venous and arterial thrombosis.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Anpocogin, a variant of the Ancyclostoma canium nematode anticoagulant protein c2 with an added C-terminal P85, is synthesized in Pichia pastoris and functions as an anticoagulant agent [1].Recombinant nematode anticoagulant protein c2 (rNAPc2) is a potent inhibitor of serine protease factor VIIa and its cell-associated cofactor tissue factor FVIIa/TF, a key physiological initiator of blood coagulation, with potential efficacy in the treatment of disseminated intravascular coagulopathy and venous and arterial thrombosis. |
Molecular Weight | 9745.62 |
Formula | C401H617N111O1148S12 |
Cas No. | 2725767-44-0 |
Sequence | Lys-Ala-Thr-Met-Gln-Cys-Gly-Glu-Asn-Glu-Lys-Tyr-Asp-Ser-Cys-Gly-Ser-Lys-Glu-Cys-Asp-Lys-Lys-Cys-Lys-Tyr-Asp-Gly-Val-Glu-Glu-Glu-Asp-Asp-Glu-Glu-Pro-Asn-Val-Pro-Cys-Leu-Val-Arg-Val-Cys-His-Gln-Asp-Cys-Val-Cys-Glu-Glu-Gly-Phe-Tyr-Arg-Asn-Lys-Asp-Asp-Lys-Cys |
Sequence Short | KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.