Your shopping cart is currently empty

Anpocogin, a variant of the Ancyclostoma canium nematode anticoagulant protein c2 with an added C-terminal P85, is synthesized in Pichia pastoris and functions as an anticoagulant agent [1].Recombinant nematode anticoagulant protein c2 (rNAPc2) is a potent inhibitor of serine protease factor VIIa and its cell-associated cofactor tissue factor FVIIa/TF, a key physiological initiator of blood coagulation, with potential efficacy in the treatment of disseminated intravascular coagulopathy and venous and arterial thrombosis.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Anpocogin, a variant of the Ancyclostoma canium nematode anticoagulant protein c2 with an added C-terminal P85, is synthesized in Pichia pastoris and functions as an anticoagulant agent [1].Recombinant nematode anticoagulant protein c2 (rNAPc2) is a potent inhibitor of serine protease factor VIIa and its cell-associated cofactor tissue factor FVIIa/TF, a key physiological initiator of blood coagulation, with potential efficacy in the treatment of disseminated intravascular coagulopathy and venous and arterial thrombosis. |
| Molecular Weight | 9745.62 |
| Formula | C401H617N111O1148S12 |
| Cas No. | 2725767-44-0 |
| Sequence | Lys-Ala-Thr-Met-Gln-Cys-Gly-Glu-Asn-Glu-Lys-Tyr-Asp-Ser-Cys-Gly-Ser-Lys-Glu-Cys-Asp-Lys-Lys-Cys-Lys-Tyr-Asp-Gly-Val-Glu-Glu-Glu-Asp-Asp-Glu-Glu-Pro-Asn-Val-Pro-Cys-Leu-Val-Arg-Val-Cys-His-Gln-Asp-Cys-Val-Cys-Glu-Glu-Gly-Phe-Tyr-Arg-Asn-Lys-Asp-Asp-Lys-Cys-Val-Ser-Ala-Glu-Asp-Cys-Glu-Leu-Asp-Asn-Met-Asp-Phe-Ile-Tyr-Pro-Gly-Thr-Arg-Asn-Pro |
| Sequence Short | KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.