angiotensin-converting enzyme

Angiotensin-converting enzyme (Kininase II) is a zinc-dependent peptidase and extracellular enzyme that acts as a counterbalance to ACE in the renin-angiotensin system.Angiotensin-converting enzyme is a potent vasoconstrictor used in the study of cardiovascular and immune diseases. Angiotensin-converting enzyme is a potent vasoconstrictor used to study cardiovascular and immune diseases.

L-Isoleucyl-L-arginine, a dipeptide composed of L-isoleucine and L-arginine, acts as a potent angiotensin-converting enzyme (ACE) inhibitor and is utilized in hypertension research [1].

Ovalbumin (154-159), a peptide fragment derived from ovalbumin, acts as a potent inhibitor of the angiotensin-converting enzyme (ACE) and is utilized in hypertension research [1] [2].

Ovotransferrin (328-332), with an IC50 of 20 μM, exhibits protective activity against hypertension by inhibiting the Angiotensin-Converting Enzyme (ACE) and also displays anti-Cholinesterase (ChE) activity, suggesting a potential role in the treatment of Alzheimer's disease [1] [2].

Acein acetate is a high-affinity angiotensin-converting enzyme (ACE) ligand (Kd = 2.79 nM). Concentrations up to 500 nM had no significant effect on ACE enzyme activity. Enhanced NMDA + D-serine-induced dopamine release from striatal slices in vitro and striatum in vivo.

Acetyl Ser-Asp-Lys-Pro is formed in bone marrow cells by enzymatic processing of thymosin β4. It inhibits the entry of pluripotent hemopoietic stem cells into S-phase of the cell cycle and protects against Ara-C lethality in mice.

Tuna AI acetate is an inhibitor of angiotensin-converting enzyme (ACE) in non-competitive manner derived from tuna muscle.

H-Val-Pro-Pro-OH is an inhibitor of Angiotensin I converting enzyme (ACE)( IC50 : 9 μM).

Hemorphin-7 acetate is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

Acein is a High affinity angiotensin-converting enzyme (ACE) ligand (Kd = 2.79 nM). Exhibits no significant effect on ACE enzymatic activity up to 500 nM concentration. Potentiates NMDA + D-serine-induced dopamine release from striatal slices in vitro and the striatum in vivo.

N-Acetyl-Ser-Asp-Lys-Pro (TFA) is an endogenous tetrapeptide produced in the bone marrow, serving as a specific substrate for the N-terminal site of angiotensin-converting enzyme (ACE).

Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE). The Bradykinin (BK) fragment (1-5) (RPPGF) is one of the most stable naturally occurring metabolites and may be used as a marker for BK production in vivo.

Abz-Ser-Pro-3-nitro-Tyr is a substrate of ACE2 (angiotensin-converting enzyme-2) [1].

N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate, a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE), functions as a natural inhibitor of pluripotent hematopoietic stem cell proliferation and exhibits anti-inflammatory and antifibrotic properties [1] [2].

H-Ile-Pro-Pro-OH, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE)[1] with an IC50 of 5 μM.

DX600 is a useful organic compound for research related to life sciences. The catalog number is T35324 and the CAS number is 478188-26-0.

N-Hippuryl-His-Leu hydrate (N-Benzoyl-Gly-His-Leu hydrate) is a peptide compound that is an angiotensin-converting enzyme (ACE) substrate and can be used as a model peptide for measuring ACE-I inhibitory activity.

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine, is a 4-amino acid peptide known for its blood pressure-lowering effects and its role as an angiotensin-converting enzyme (ACE) inhibitor. This compound is frequently used in high blood pressure research.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].

H-Ile-Pro-Pro-OH hydrochloride, a tripeptide derived from milk [1], functions as an ACE inhibitor [1] with an IC 50 of 5 μM [2], and is recognized for its antihypertensive properties [1].

Hippuryl-His-Leu-OH serves as a substrate to measure angiotensin I converting enzyme activity. Upon its cleavage, the resultant His-Leu moiety reacts with o-phthaldialdehyde or Fluorescamine, facilitating fluorescence detection [1] [2] [3].

H-Pro-Phe-OH, a dipeptide composed of proline and phenylalanine, functions both as a substrate for prolinase and in polypeptide synthesis. Phenylalanine, an aromatic amino acid within this compound, has the capability to inhibit the activity of Angiotensin-converting enzyme (ACE) [1] [2].

Excellent angiotensin I-converting enzyme (ACE) substrate with a Km value of 4.0 μM and a kcat value of 210s-1.

Abz-FR-K(Dnp)-P-OH acetate is an excellent angiotensin I-converting enzyme (ACE) substrate with a Km value of 4.0 μM and a kcat value of 210s-1.