keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
5 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1]. |
Molecular Weight | 3649.88 |
Formula | C164H238N40O55 |
keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
You can also refer to dose conversion for different animals. More
bottom
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc.
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN inhibitor inhibit