keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
5 mg | Inquiry | $ 678.00 | |
10 mg | Inquiry | $ 1,180.00 |
Description | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions. |
Molecular Weight | N/A |
keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
You can also refer to dose conversion for different animals. More
bottom
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc.
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ inhibitor inhibit