fy

Z-FY-CHO (Z-Phe-Tyr-CHO) is a selective histone L (Cat L) inhibitor that promotes autophagy, reduces the accumulation of P62, and blocks the activation of caspase-3 and PARP.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].

Beefy meaty peptide is a bioactive chemical.

FLDKFNHEAEDLFYQSSL is an 18-residue peptide that binds to the SARS-CoV-2 receptor-binding domain (RBD). It inhibits the entry of SARS-CoV-2 and also interacts with binding residues (Leu455, Phe456, Ala475, and Gln493).

Cyclic(YCDGFYACYMDV) is a HER2 signaling pathway inhibitor with anticancer properties. In aqueous solution, Cyclic(YCDGFYACYMDV) self-assembles into nanoparticles that target HER2 on cancer cells, converting into nanofibrils. This process disrupts HER2 dimerization and subsequent downstream signaling, leading to apoptosis (Apoptosis) of cancer cells. Its inhibitory effect on HER2-positive breast cancer has been demonstrated as effective in mouse xenograft models.