Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1. Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1. Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex. |
Species | Mouse |
Expression System | E. coli |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Accession Number | Q9JKP8 |
Synonyms | CHRAC-1, NF-YC-like protein, Chrac1, YCL1, Chromatin accessibility complex protein 1, DNA polymerase epsilon subunit p15, YC-like protein 1 |
Amino Acid | ADAAVGKEKCGDQRLVSLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQYLATCSYRHGSGKAKKALTYSDLASTAEDSETLQFLADILPKKILASKYLKMLKEKREEEEDNEDDGSDLGEALA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 2-129 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 21.4 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1. Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CHRAC1 Protein, Mouse, Recombinant (His & Myc) CHRAC-1 NF-YC-like protein Chrac1 YCL1 Chromatin accessibility complex protein 1 DNA polymerase epsilon subunit p15 YC-like protein 1 recombinant recombinant-proteins proteins protein