Home Tools
Log in
Cart

CHRAC1 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02580
Synonyms: CHRAC-1, NF-YC-like protein, Chrac1, YCL1, Chromatin accessibility complex protein 1, DNA polymerase epsilon subunit p15, YC-like protein 1

Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1. Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CHRAC1 Protein, Mouse, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1. Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex.
Species Mouse
Expression System E. coli
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number Q9JKP8
Synonyms CHRAC-1, NF-YC-like protein, Chrac1, YCL1, Chromatin accessibility complex protein 1, DNA polymerase epsilon subunit p15, YC-like protein 1
Amino Acid ADAAVGKEKCGDQRLVSLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQYLATCSYRHGSGKAKKALTYSDLASTAEDSETLQFLADILPKKILASKYLKMLKEKREEEEDNEDDGSDLGEALA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 2-129 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 21.4 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1. Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CHRAC1 Protein, Mouse, Recombinant (His & Myc) CHRAC-1 NF-YC-like protein Chrac1 YCL1 Chromatin accessibility complex protein 1 DNA polymerase epsilon subunit p15 YC-like protein 1 recombinant recombinant-proteins proteins protein

 

TargetMol