exendin-4

Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).

Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is utilized in the study of diabetes and hypothalamic-pituitary-adrenal (HPA) axis disorders [1] [2].

Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP-1-R) antagonist that regulates blood glucose. Des His1, Glu8 Exendin-4 is used in the study of diabetes and obesity.

Exendin-4, Cy5 labeled (Exendin-4-Cys(Cy5)) is an Exendin-4 linked covalently with a Cy5 fluorophore, functioning as a GLP-1 receptor agonist. This compound enables in vivo imaging of β cells, offering a means to assess the dynamic expression of GLP-1R, particularly in type 2 diabetes models.

Exendin-4-Lys-azide TFA (Compound Ex40) is an azide derivative of Exendin-4, which is suitable for conjugation and click chemistry applications.

Exendin-4-Cys is a cysteine-modified form of Exendin-4. It is conjugated with LMWC-PDP and can be utilized in research related to type 2 diabetes.

Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.

Exendin 4, biotin labeled, is a bioactive peptide.

Exendin-3/4 (64-86) is a polypeptide composed of a specific amino acid sequence within the exendin-3 or exendin-4 peptide chains.

KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia[1]. [1]. US20150315260 A1

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Exendin-3/4 (59-86) is a derivative of the Exendin-4 peptide.

{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.

SDV-Exendin-3/4 is a 32-amino acid peptide. Derived from the salivary gland of the Gila monster (Heloderma suspectum), this peptide is a ligand for the GLP-1 receptor, playing a key role in glucose metabolism and insulin secretion. It exhibits significant potential for therapeutic applications in diabetes management.

Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.